Web Analysis for Specminds - specminds.com

1.67 Rating by CuteStat

specminds.com is 7 years 10 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, specminds.com is SAFE to browse.

PageSpeed Score
99
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig
- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati
- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95

.: Musicologist Raja | Exclusive Telugu Lyrics Website | Telugu Film S
- rajamusicbank.com
622,720 $ 1,920.00

.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.
- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sat, 16 Jan 2016 02:53:36 GMT
Server: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
Content-Length: 203
Connection: close
Content-Type: text/html;charset=ISO-8859-1

Domain Information

Domain Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registration Date: Jul 1, 2016, 12:00 AM 7 years 10 months 1 day ago
Last Modified: Jan 7, 2016, 12:00 AM 8 years 3 months 3 weeks ago
Expiration Date: Jul 1, 2017, 12:00 AM 6 years 10 months 6 hours ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns1.lazybulls.com 103.24.200.143 India India
ns2.lazybulls.com 103.24.202.176 India India

DNS Record Analysis

Host Type TTL Extra
specminds.com A 14399 IP: 103.24.200.143
specminds.com NS 21599 Target: ns1.lazybulls.com
specminds.com NS 21599 Target: ns2.lazybulls.com
specminds.com SOA 21599 MNAME: ns1.lazybulls.com
RNAME: info.lazybulls.com
Serial: 2016010704
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
specminds.com MX 14399 Target: specminds.com

Full WHOIS Lookup

Domain Name: SPECMINDS.COM
Registry Domain ID: 1992291973_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2016-01-07T16:54:16Z
Creation Date: 2016-01-07T16:53:55Z
Registrar Registration Expiration Date: 2017-01-07T16:53:55Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID:
Registrant Name: Lazy Bulls Domain and Hosting Services
Registrant Organization: Lazy Bulls
Registrant Street: Banjara Hills
Registrant City: Hyderabad
Registrant State/Province: Andhra Pradesh
Registrant Postal Code: 500034
Registrant Country: IN
Registrant Phone: +91.8885435555
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: domains@lazybulls.com
Registry Admin ID:
Admin Name: Lazy Bulls Domain and Hosting Services
Admin Organization: Lazy Bulls
Admin Street: Banjara Hills
Admin City: Hyderabad
Admin State/Province: Andhra Pradesh
Admin Postal Code: 500034
Admin Country: IN
Admin Phone: +91.8885435555
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: domains@lazybulls.com
Registry Tech ID:
Tech Name: Lazy Bulls Domain and Hosting Services
Tech Organization: Lazy Bulls
Tech Street: Banjara Hills
Tech City: Hyderabad
Tech State/Province: Andhra Pradesh
Tech Postal Code: 500034
Tech Country: IN
Tech Phone: +91.8885435555
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: domains@lazybulls.com
Name Server: ns1.lazybulls.com
Name Server: ns2.lazybulls.com
DNSSEC:Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1-2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>>Last update of WHOIS database: 2016-01-16T02:54:02+0000Z
Top Websites • CuteStat Lite Tutorials • Privacy Policy • CuteStat Bot • Update or Remove • Contact Us • What is My IP • Customer Login
Copyright © 2009 - 2024 CuteStat, All Rights Reserved.
Any other brand information used from us are the properties of their respective owners.